Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species) |
Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries) |
Domain d1ob1e2: 1ob1 E:114-212 [86757] Other proteins in same PDB: d1ob1a1, d1ob1a2, d1ob1b1, d1ob1c1, d1ob1c2, d1ob1d1, d1ob1d2, d1ob1e1, d1ob1f1, d1ob1f2 part of anti-Pf MSP1 Fab complexed with cac |
PDB Entry: 1ob1 (more details), 2.9 Å
SCOP Domain Sequences for d1ob1e2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ob1e2 b.1.1.2 (E:114-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)} akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep
Timeline for d1ob1e2: