Lineage for d1ob1e2 (1ob1 E:114-212)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 549023Protein Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma [88574] (5 species)
  7. 549177Species Mouse (Mus musculus) [TaxId:10090] [88576] (302 PDB entries)
  8. 549518Domain d1ob1e2: 1ob1 E:114-212 [86757]
    Other proteins in same PDB: d1ob1a1, d1ob1a2, d1ob1b1, d1ob1c1, d1ob1c2, d1ob1d1, d1ob1d2, d1ob1e1, d1ob1f1, d1ob1f2
    part of anti-Pf MSP1 Fab
    complexed with cac

Details for d1ob1e2

PDB Entry: 1ob1 (more details), 2.9 Å

PDB Description: crystal structure of a fab complex whith plasmodium falciparum msp1-19

SCOP Domain Sequences for d1ob1e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ob1e2 b.1.1.2 (E:114-212) Immunoglobulin heavy chain gamma constant domain 1, CH1-gamma {Mouse (Mus musculus)}
akttapsvyplapvcgdttgssvtlgclvkgyfpepvtltwnsgslssgvhtfpavlqsd
lytlsssvtvtsstwpsqsitcnvahpasstkvdkkiep

SCOP Domain Coordinates for d1ob1e2:

Click to download the PDB-style file with coordinates for d1ob1e2.
(The format of our PDB-style files is described here.)

Timeline for d1ob1e2: