Lineage for d1ob1a2 (1ob1 A:107-213)

  1. Root: SCOP 1.73
  2. 651986Class b: All beta proteins [48724] (165 folds)
  3. 651987Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 651988Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 654118Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 655938Protein Immunoglobulin light chain kappa constant domain, CL-kappa [88566] (3 species)
  7. 656129Species Mouse (Mus musculus) [TaxId:10090] [88567] (311 PDB entries)
  8. 656464Domain d1ob1a2: 1ob1 A:107-213 [86749]
    Other proteins in same PDB: d1ob1a1, d1ob1b1, d1ob1b2, d1ob1c1, d1ob1c2, d1ob1d1, d1ob1e1, d1ob1e2, d1ob1f1, d1ob1f2

Details for d1ob1a2

PDB Entry: 1ob1 (more details), 2.9 Å

PDB Description: crystal structure of a fab complex whith plasmodium falciparum msp1-19
PDB Compounds: (A:) antibody, heavy chain

SCOP Domain Sequences for d1ob1a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ob1a2 b.1.1.2 (A:107-213) Immunoglobulin light chain kappa constant domain, CL-kappa {Mouse (Mus musculus) [TaxId: 10090]}
radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqd
skdstysmsstltltkdeyerhnsytceathktstspivksfnrnec

SCOP Domain Coordinates for d1ob1a2:

Click to download the PDB-style file with coordinates for d1ob1a2.
(The format of our PDB-style files is described here.)

Timeline for d1ob1a2: