Lineage for d1oaod_ (1oao D:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2574099Fold e.26: Prismane protein-like [56820] (1 superfamily)
    3 domains: (1) spectrin repeat-like 3-helical bundle; (2 and 3) alpha/beta: Rossmann-fold topology
  4. 2574100Superfamily e.26.1: Prismane protein-like [56821] (4 families) (S)
  5. 2574168Family e.26.1.3: Acetyl-CoA synthase [82852] (3 proteins)
    4 domains: structures and assembly of domains 1 and 2 are similar to those of domains 1 and 3 of the CODH subunit; (3 and 4) alpha+beta
  6. 2574169Protein Bifunctional carbon monoxide dehydrogenase/acetyl-CoA synthase (CODH/ACS) alpha (ACS) subunit [82853] (1 species)
  7. 2574170Species Moorella thermoacetica [TaxId:1525] [82854] (2 PDB entries)
  8. 2574172Domain d1oaod_: 1oao D: [86747]
    Other proteins in same PDB: d1oaoa_, d1oaob_
    complexed with act, bct, fe2, for, gol, ni, sf4, so4, sx, xcc, zn

Details for d1oaod_

PDB Entry: 1oao (more details), 1.9 Å

PDB Description: nizn[fe4s4] and nini[fe4s4] clusters in closed and open alpha subunits of acetyl-coa synthase/carbon monoxide dehydrogenase
PDB Compounds: (D:) Carbon monoxide dehydrogenase/acetyl-CoA synthase subunit alpha

SCOPe Domain Sequences for d1oaod_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oaod_ e.26.1.3 (D:) Bifunctional carbon monoxide dehydrogenase/acetyl-CoA synthase (CODH/ACS) alpha (ACS) subunit {Moorella thermoacetica [TaxId: 1525]}
tdfdkifegaipegkepvalfrevyhgaitatsyaeillnqairtygpdhpvgypdtayy
lpvircfsgeevkklgdlppilnrkraqvspvlnfenarlageatwyaaeiiealrylky
kpdepllpppwtgfigdpvvrrfgikmvdwtipgeaiilgrakdskalakivkelmgmgf
mlficdeaveqlleenvklgidyiayplgnftqivhaanyalragmmfggvtpgareeqr
dyqrrrirafvlylgehdmvktaaafgaiftgfpvitdqplpedkqipdwffsvedydki
vqiametrgikltkikldlpinfgpafegesirkgdmyvemggnrtpafelvrtvsesei
tdgkievigpdidqipegsklplgilvdiygrkmqadfegvlerrihdfinygeglwhtg
qrninwlrvskdavakgfrfknygeilvakmkeefpaivdrvqvtiftdeakvkeymeva
rekykerddrmrgltdetvdtfyscvlcqsfapnhvcivtpervglcgavswldakasye
inhagpnqpipkegeidpikgiwksvndylytasnrnleqvclytlmenpmtscgcfeai
mailpecngimittrdhagmtpsgmtfstlagmigggtqtpgfmgigrtyivskkfisad
ggiarivwmpkslkdflhdefvrrsveeglgedfidkiadetigttvdeilpyleekghp
altmdpim

SCOPe Domain Coordinates for d1oaod_:

Click to download the PDB-style file with coordinates for d1oaod_.
(The format of our PDB-style files is described here.)

Timeline for d1oaod_: