Lineage for d1oaoc_ (1oao C:)

  1. Root: SCOP 1.65
  2. 338536Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)
  3. 339855Fold e.26: Prismane protein-like [56820] (1 superfamily)
    3 domains: (1) spectrin repeat-like 3-helical bundle; (2 and 3) alpha/beta: Rossmann-fold topology
  4. 339856Superfamily e.26.1: Prismane protein-like [56821] (3 families) (S)
  5. 339891Family e.26.1.3: Bifunctional carbon monoxide dehydrogenase/acethyl-CoA synthase (CODH/ACS) alpha (ACS) subunit [82852] (1 protein)
    4 domains: structures and assembly of domains 1 and 2 are similar to those of domains 1 and 3 of the CODH subunit; (3 and 4) alpha+beta
  6. 339892Protein Bifunctional carbon monoxide dehydrogenase/acethyl-CoA synthase (CODH/ACS) alpha (ACS) subunit [82853] (1 species)
  7. 339893Species Moorella thermoacetica [TaxId:1525] [82854] (2 PDB entries)
  8. 339894Domain d1oaoc_: 1oao C: [86746]
    Other proteins in same PDB: d1oaoa_, d1oaob_

Details for d1oaoc_

PDB Entry: 1oao (more details), 1.9 Å

PDB Description: nizn[fe4s4] and nini[fe4s4] clusters in closed and open alpha subunits of acetyl-coa synthase/carbon monoxide dehydrogenase

SCOP Domain Sequences for d1oaoc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oaoc_ e.26.1.3 (C:) Bifunctional carbon monoxide dehydrogenase/acethyl-CoA synthase (CODH/ACS) alpha (ACS) subunit {Moorella thermoacetica}
mtdfdkifegaipegkepvalfrevyhgaitatsyaeillnqairtygpdhpvgypdtay
ylpvircfsgeevkklgdlppilnrkraqvspvlnfenarlageatwyaaeiiealrylk
ykpdepllpppwtgfigdpvvrrfgikmvdwtipgeaiilgrakdskalakivkelmgmg
fmlficdeaveqlleenvklgidyiayplgnftqivhaanyalragmmfggvtpgareeq
rdyqrrrirafvlylgehdmvktaaafgaiftgfpvitdqplpedkqipdwffsvedydk
ivqiametrgikltkikldlpinfgpafegesirkgdmyvemggnrtpafelvrtvsese
itdgkievigpdidqipegsklplgilvdiygrkmqadfegvlerrihdfinygeglwht
gqrninwlrvskdavakgfrfknygeilvakmkeefpaivdrvqvtiftdeakvkeymev
arekykerddrmrgltdetvdtfyscvlcqsfapnhvcivtpervglcgavswldakasy
einhagpnqpipkegeidpikgiwksvndylytasnrnleqvclytlmenpmtscgcfea
imailpecngimittrdhagmtpsgmtfstlagmigggtqtpgfmgigrtyivskkfisa
dggiarivwmpkslkdflhdefvrrsveeglgedfidkiadetigttvdeilpyleekgh
paltmdpim

SCOP Domain Coordinates for d1oaoc_:

Click to download the PDB-style file with coordinates for d1oaoc_.
(The format of our PDB-style files is described here.)

Timeline for d1oaoc_: