Lineage for d1oaoa_ (1oao A:)

  1. Root: SCOP 1.65
  2. 338536Class e: Multi-domain proteins (alpha and beta) [56572] (38 folds)
  3. 339855Fold e.26: Prismane protein-like [56820] (1 superfamily)
    3 domains: (1) spectrin repeat-like 3-helical bundle; (2 and 3) alpha/beta: Rossmann-fold topology
  4. 339856Superfamily e.26.1: Prismane protein-like [56821] (3 families) (S)
  5. 339872Family e.26.1.2: Carbon monoxide dehydrogenase [64514] (2 proteins)
  6. 339873Protein Bifunctional carbon monoxide dehydrogenase/acethyl-CoA synthase (CODH/ACS) beta (CODH) subunit [82850] (1 species)
  7. 339874Species Moorella thermoacetica [TaxId:1525] [82851] (2 PDB entries)
  8. 339875Domain d1oaoa_: 1oao A: [86744]
    Other proteins in same PDB: d1oaoc_, d1oaod_

Details for d1oaoa_

PDB Entry: 1oao (more details), 1.9 Å

PDB Description: nizn[fe4s4] and nini[fe4s4] clusters in closed and open alpha subunits of acetyl-coa synthase/carbon monoxide dehydrogenase

SCOP Domain Sequences for d1oaoa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oaoa_ e.26.1.2 (A:) Bifunctional carbon monoxide dehydrogenase/acethyl-CoA synthase (CODH/ACS) beta (CODH) subunit {Moorella thermoacetica}
prfrdlshncrpseaprvmepknrdrtvdpavlemlvkskddkvitafdrfvaqqpqcki
gyegiccrfcmagpcrikatdgpgsrgicgasawtivarnvglmiltgaaahcehgnhia
halvemaegkapdysvkdeaklkevcrrvgievegksvlelaqevgekaledfrrlkgeg
eatwlmttinegrkekfrthnvvpfgihasiselvnqahmgmdndpvnlvfsairvalad
ytgehiatdfsdilfgtpqpvvseanmgvldpdqvnfvlhghnpllseiivqaaremege
akaagakginlvgicctgnevlmrqgiplvtsfasqelaictgaidamcvdvqcimpsis
avaecyhtriittadnakipgayhidyqtataiesaktairmaieafkerkesnrpvyip
qiknrvvagwslealtkllatqnaqnpirvlnqaildgelagvalicgcnnlkgfqdnsh
ltvmkellknnvfvvatgcsaqaagklglldpanvetycgdglkgflkrlgeganieigl
ppvfhmgscvdnsravdllmamandlgvdtpkvpfvasapeamsgkaaaigtwwvslgvp
thvgtmppvegsdliysiltqiasdvyggyfifemdpqvaarkildaleyrtwklgvhke
vaeryetklcqgy

SCOP Domain Coordinates for d1oaoa_:

Click to download the PDB-style file with coordinates for d1oaoa_.
(The format of our PDB-style files is described here.)

Timeline for d1oaoa_: