SCOPe 2.08: Domain d1oana2: 1oan A:1-297

Lineage for d1oana2 (1oan A:1-297)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.10: Viral glycoprotein, central and dimerisation domains [56982] (1 superfamily)
   2 intertwined domains; all-beta and alpha+beta

4. Superfamily f.10.1: Viral glycoprotein, central and dimerisation domains [56983] (2 families)

5. Family f.10.1.1: Viral glycoprotein, central and dimerisation domains [56984] (3 proteins)

6. Protein Envelope glycoprotein [56985] (2 species)

7. Species Dengue virus type 2 [TaxId:11060] [90131] (8 PDB entries)
   Uniprot P12823 281-675

8. Domain d1oana2: 1oan A:1-297 [86741]
   Other proteins in same PDB: d1oana1, d1oanb1
   complexed with na, nag

Details for d1oana2

PDB Entry: 1oan, 2.75 Å

PDB Description: crystal structure of the dengue 2 virus envelope protein

PDB Compounds: (A:) Envelope glycoprotein

SCOPe Domain Sequences for d1oana2:

Sequence; same for both SEQRES and ATOM records:

>d1oana2 f.10.1.1 (A:1-297) Envelope glycoprotein {Dengue virus type 2 [TaxId: 11060]}
mrcigisnrdfvegvsggswvdivlehgscvttmaknkptldfelikteakqpatlrkyc
ieakltntttesrcptqgeptlneeqdkrfvckhsmvdrgwgngcglfgkggivtcamft
ckknmegkivqpenleytvvitphsgeehavgndtgkhgkevkitpqssiteaeltgygt
vtmecsprtgldfnemvllqmkdkawlvhrqwfldlplpwlpgadtqgsnwiqketlvtf
knphakkqdvvvlgsqegamhtaltgateiqmssgnllftghlkcrlrmdklqlkgm

Timeline for d1oana2:

• d1oana2 first appeared in SCOP 1.65
  
• d1oana2 appears in SCOPe 2.07