Lineage for d1oala_ (1oal A:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2763708Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (2 families) (S)
    has additional strand at N-terminus
  5. 2763709Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (3 proteins)
  6. 2763729Protein Cu,Zn superoxide dismutase, SOD [49331] (16 species)
  7. 2764343Species Photobacterium leiognathi [TaxId:553611] [49337] (9 PDB entries)
  8. 2764347Domain d1oala_: 1oal A: [86739]
    complexed with cu, zn

Details for d1oala_

PDB Entry: 1oal (more details), 1.5 Å

PDB Description: active site copper and zinc ions modulate the quaternary structure of prokaryotic cu,zn superoxide dismutase
PDB Compounds: (A:) superoxide dismutase

SCOPe Domain Sequences for d1oala_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1oala_ b.1.8.1 (A:) Cu,Zn superoxide dismutase, SOD {Photobacterium leiognathi [TaxId: 553611]}
qdltvkmtdlqtgkpvgtielsqnkygvvfipeladltpgehgfhihqngscassekdgk
vvlggaagghydpehtnkhgfpwtddnhkgdlpalfvsanglatnpvlaprltlkelkgh
aimihaggdnhsdmpkalggggarvacgviq

SCOPe Domain Coordinates for d1oala_:

Click to download the PDB-style file with coordinates for d1oala_.
(The format of our PDB-style files is described here.)

Timeline for d1oala_: