SCOP 1.69: Domain d1o9rd_: 1o9r D:

Lineage for d1o9rd_ (1o9r D:)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.25: Ferritin-like [47239] (2 superfamilies)
   core: 4 helices; bundle, closed, left-handed twist; 1 crossover connection

4. Superfamily a.25.1: Ferritin-like [47240] (3 families)
   contains bimetal-ion centre in the middle of the bundle

5. Family a.25.1.1: Ferritin [47241] (7 proteins)

6. Protein Dodecameric ferritin homolog [47250] (10 species)

7. Species Agrobacterium tumefaciens, Dps [TaxId:358] [89027] (1 PDB entry)

8. Domain d1o9rd_: 1o9r D: [86709]

Details for d1o9rd_

PDB Entry: 1o9r, 1.45 Å

PDB Description: the x-ray crystal structure of agrobacterium tumefaciens dps, a member of the family that protect dna without binding

SCOP Domain Sequences for d1o9rd_:

Sequence; same for both SEQRES and ATOM records:

>d1o9rd_ a.25.1.1 (D:) Dodecameric ferritin homolog {Agrobacterium tumefaciens, Dps}
thktkndlpsnakstvigilneslasvidlalvtkqahwnlkgpqfiavhelldtfrtql
dnhgdtiaervvqlggtalgslqavssttklkayptdiykihdhldalierygevanmir
kaiddsdeagdpttadiftaasrdldkslwfleahvqeks

Timeline for d1o9rd_:

• d1o9rd_ first appeared in SCOP 1.65
  
• d1o9rd_ appears in SCOP 1.67
  
• d1o9rd_ appears in SCOP 1.71
  
• d1o9rd_ appears in the current release, SCOPe 2.08