Lineage for d1o9kb_ (1o9k B:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2718075Fold a.74: Cyclin-like [47953] (1 superfamily)
    core: 5 helices; one helix is surrounded by the others
  4. 2718076Superfamily a.74.1: Cyclin-like [47954] (4 families) (S)
    duplication: consists of two domains of this fold
  5. 2718685Family a.74.1.3: Retinoblastoma tumor suppressor domains [47969] (1 protein)
  6. 2718686Protein Retinoblastoma tumor suppressor domains [47970] (1 species)
    contains an additional C-terminal helix
  7. 2718687Species Human (Homo sapiens) [TaxId:9606] [47971] (7 PDB entries)
  8. 2718700Domain d1o9kb_: 1o9k B: [86699]
    domain A - chains A, C, E, G; domain B - chains B, D, F, H; complexed with E2F peptide, chains P, Q, R, S
    has additional insertions and/or extensions that are not grouped together

Details for d1o9kb_

PDB Entry: 1o9k (more details), 2.6 Å

PDB Description: crystal structure of the retinoblastoma tumour suppressor protein bound to e2f peptide
PDB Compounds: (B:) Retinoblastoma-associated protein

SCOPe Domain Sequences for d1o9kb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o9kb_ a.74.1.3 (B:) Retinoblastoma tumor suppressor domains {Human (Homo sapiens) [TaxId: 9606]}
stslslfykkvyrlaylrlntlcerllsehpelehiiwtlfqhtlqneyelmrdrhldqi
mmcsmygickvknidlkfkiivtaykdlphavqetfkrvlikeeeydsiivfynsvfmqr
lktnilqyastrpptlspiphipr

SCOPe Domain Coordinates for d1o9kb_:

Click to download the PDB-style file with coordinates for d1o9kb_.
(The format of our PDB-style files is described here.)

Timeline for d1o9kb_: