SCOP 1.75: Domain d1o3xa_: 1o3x A:

Lineage for d1o3xa_ (1o3x A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.8: GAT-like domain [89009] (2 families)

5. Family a.7.8.1: GAT domain [89010] (3 proteins)
   this is a repeat family; one repeat unit is 1yd8 G:208-299 found in domain

6. Protein ADP-ribosylation factor binding protein Gga1 [89011] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89012] (6 PDB entries)
   Uniprot Q9UJY5 211-299

8. Domain d1o3xa_: 1o3x A: [86617]

Details for d1o3xa_

PDB Entry: 1o3x, 2.1 Å

PDB Description: Crystal structure of human GGA1 GAT domain

PDB Compounds: (A:) ADP-ribosylation factor binding protein GGA1

SCOP Domain Sequences for d1o3xa_:

Sequence; same for both SEQRES and ATOM records:

>d1o3xa_ a.7.8.1 (A:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]}
aanklikemvqedqkrmekiskrvnaieevnnnvklltemvmshsqggaaagssedlmke
lyqrcermrptlfrlasdtedndealaeilqandnltqvinlykqlvrgeev

Timeline for d1o3xa_:

• d1o3xa_ first appeared in SCOP 1.65
  
• d1o3xa_ appears in SCOP 1.73
  
• d1o3xa_ appears in SCOPe 2.01
  
• d1o3xa_ appears in the current release, SCOPe 2.08