Lineage for d1o2db_ (1o2d B:)

  1. Root: SCOPe 2.05
  2. 1949014Class e: Multi-domain proteins (alpha and beta) [56572] (68 folds)
  3. 1953870Fold e.22: Dehydroquinate synthase-like [56795] (1 superfamily)
    2 domains: (1) alpha/beta of a Rossmann-fold topology, binds NAD (2) multihelical array
  4. 1953871Superfamily e.22.1: Dehydroquinate synthase-like [56796] (3 families) (S)
  5. 1953901Family e.22.1.2: Iron-containing alcohol dehydrogenase [69892] (6 proteins)
    Pfam PF00465
  6. 1953902Protein Alcohol dehydrogenase TM0920 [75612] (1 species)
  7. 1953903Species Thermotoga maritima [TaxId:2336] [75613] (2 PDB entries)
  8. 1953905Domain d1o2db_: 1o2d B: [86592]
    structural genomics; high-resolution structure
    complexed with fe, nap, trs

Details for d1o2db_

PDB Entry: 1o2d (more details), 1.3 Å

PDB Description: crystal structure of alcohol dehydrogenase, iron-containing (tm0920) from thermotoga maritima at 1.30 a resolution
PDB Compounds: (B:) Alcohol dehydrogenase, iron-containing

SCOPe Domain Sequences for d1o2db_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o2db_ e.22.1.2 (B:) Alcohol dehydrogenase TM0920 {Thermotoga maritima [TaxId: 2336]}
hhvwefymptdvffgekilekrgniidllgkralvvtgkssskkngslddlkklldetei
syeifdeveenpsfdnvmkaveryrndsfdfvvglgggspmdfakavavllkekdlsved
lydrekvkhwlpvveipttagtgsevtpysiltdpegnkrgctlmfpvyafldprytysm
sdeltlstgvdalshavegylsrkstppsdalaieamkiihrnlpkaiegnrearkkmfv
asclagmviaqtgttlahalgyplttekgikhgkatgmvlpfvmevmkeeipekvdtvnh
ifggsllkflkelglyekvavsseelekwvekgsrakhlkntpgtftpekirniyrealg

SCOPe Domain Coordinates for d1o2db_:

Click to download the PDB-style file with coordinates for d1o2db_.
(The format of our PDB-style files is described here.)

Timeline for d1o2db_: