Lineage for d1o2ca_ (1o2c A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 328997Superfamily d.58.5: GlnB-like [54913] (4 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 329029Family d.58.5.4: DUF190/COG1993 [89934] (1 protein)
  6. 329030Protein Hypothetical protein TM0021 [89935] (1 species)
  7. 329031Species Thermotoga martima [89936] (1 PDB entry)
  8. 329032Domain d1o2ca_: 1o2c A: [86590]
    structural genomics
    complexed with adp, mse, so4

Details for d1o2ca_

PDB Entry: 1o2c (more details), 2.5 Å

PDB Description: Crystal structure of hypothetical protein (TM0021) from Thermotoga maritima at 2.50 A resolution

SCOP Domain Sequences for d1o2ca_:

Sequence, based on SEQRES records: (download)

>d1o2ca_ d.58.5.4 (A:) Hypothetical protein TM0021 {Thermotoga martima}
hhmkllkiylgekdkhsgkplfeylvkrayelgmkgvtvyrgimgfghkrhmhrsdffsl
spdlpivleivdeeerinlflkeidnidfdglvftadvnvvk

Sequence, based on observed residues (ATOM records): (download)

>d1o2ca_ d.58.5.4 (A:) Hypothetical protein TM0021 {Thermotoga martima}
hhmkllkiylgekdkhsgkplfeylvkrayelgmkgvtvyrgimgfghpdlpivleivde
eerinlflkeidnidfdglvftadvnvvk

SCOP Domain Coordinates for d1o2ca_:

Click to download the PDB-style file with coordinates for d1o2ca_.
(The format of our PDB-style files is described here.)

Timeline for d1o2ca_:

  • d1o2ca_ is new in SCOP 1.65
  • d1o2ca_ does not appear in SCOP 1.67