Class d: Alpha and beta proteins (a+b) [53931] (234 folds) |
Fold d.58: Ferredoxin-like [54861] (48 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.5: GlnB-like [54913] (4 families) form timeric structures with the orthogonally packed beta-sheets |
Family d.58.5.4: DUF190/COG1993 [89934] (1 protein) |
Protein Hypothetical protein TM0021 [89935] (1 species) |
Species Thermotoga martima [89936] (1 PDB entry) |
Domain d1o2ca_: 1o2c A: [86590] structural genomics complexed with adp, mse, so4 |
PDB Entry: 1o2c (more details), 2.5 Å
SCOP Domain Sequences for d1o2ca_:
Sequence, based on SEQRES records: (download)
>d1o2ca_ d.58.5.4 (A:) Hypothetical protein TM0021 {Thermotoga martima} hhmkllkiylgekdkhsgkplfeylvkrayelgmkgvtvyrgimgfghkrhmhrsdffsl spdlpivleivdeeerinlflkeidnidfdglvftadvnvvk
>d1o2ca_ d.58.5.4 (A:) Hypothetical protein TM0021 {Thermotoga martima} hhmkllkiylgekdkhsgkplfeylvkrayelgmkgvtvyrgimgfghpdlpivleivde eerinlflkeidnidfdglvftadvnvvk
Timeline for d1o2ca_: