Lineage for d1o0ta2 (1o0t A:3-244)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 331858Fold d.92: Zincin-like [55485] (2 superfamilies)
    contains mixed beta sheet with connection over free side of the sheet
  4. 331859Superfamily d.92.1: Metalloproteases ("zincins"), catalytic domain [55486] (14 families) (S)
  5. 331960Family d.92.1.6: Serralysin-like metalloprotease, catalytic (N-terminal) domain [55508] (1 protein)
    characteristic HEXXHXXGXXH motif and Met located near C-terminus
  6. 331961Protein Metalloprotease [55509] (4 species)
    the rest of protein is all-beta sandwich containing a parallel beta-helix
  7. 331972Species Pseudomonas sp., tac ii 18 [TaxId:306] [82736] (8 PDB entries)
    psychrophilic alkaline protease
  8. 331978Domain d1o0ta2: 1o0t A:3-244 [86545]
    Other proteins in same PDB: d1o0ta1
    complexed with ca, so4

Details for d1o0ta2

PDB Entry: 1o0t (more details), 2.5 Å

PDB Description: crystal structure of a cold adapted alkaline protease from pseudomonas tac ii 18, co-crystallized with 5 mm edta (5 days)

SCOP Domain Sequences for d1o0ta2:

Sequence, based on SEQRES records: (download)

>d1o0ta2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18}
gtssaftqidnfshfydrgdhlvngkpsftvdqvadqltrsgaswhdlnndgvinltytf
ltappvgyasrglgtfsqfsalqkeqaklsleswadvakvtftegpaargddghmtfanf
sasnggaafaylpnssrkgeswylinkdyqvnktpgegnygrqtltheightlglshpgd
ynagngnptyrdavyaedtraysvmsywsekntgqvftktgegayasapllddiaavqkl
yg

Sequence, based on observed residues (ATOM records): (download)

>d1o0ta2 d.92.1.6 (A:3-244) Metalloprotease {Pseudomonas sp., tac ii 18}
gtssaftqidnfshfydrgdhlvngkpsftvdqvadqltrsgaswhdlnndgvinltytf
ltappvgyasrglgtfsqfsalqkeqaklsleswadvakvtftegpaargddghmtfanf
sasnggaafaylpnssrkgeswylinkdyqvnktpgegnygrqtltheightlglshpgd
nptyrdavyaedtraysvmsywsekntgqvftktgegayasapllddiaavqklyg

SCOP Domain Coordinates for d1o0ta2:

Click to download the PDB-style file with coordinates for d1o0ta2.
(The format of our PDB-style files is described here.)

Timeline for d1o0ta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1o0ta1