Lineage for d1o0ga_ (1o0g A:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 324599Fold d.5: RNase A-like [54075] (1 superfamily)
    contains long curved beta-sheet and 3 helices
  4. 324600Superfamily d.5.1: RNase A-like [54076] (1 family) (S)
    can be classified as disulphide-rich
  5. 324601Family d.5.1.1: Ribonuclease A-like [54077] (8 proteins)
  6. 324812Protein Seminal ribonucleasease [54086] (1 species)
  7. 324813Species Cow (Bos taurus) [TaxId:9913] [54087] (4 PDB entries)
  8. 324820Domain d1o0ga_: 1o0g A: [86531]
    mutant

Details for d1o0ga_

PDB Entry: 1o0g (more details)

PDB Description: Solution structure of the monomeric N67D mutant of bovine seminal ribonuclease

SCOP Domain Sequences for d1o0ga_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1o0ga_ d.5.1.1 (A:) Seminal ribonucleasease {Cow (Bos taurus)}
kesaaakferqhmdsgnspssssnycnlmmccrkmtqgkckpvntfvhesladvkavcsq
kkvtckdgqtncyqskstmritdcretgsskypncaykttqvekhiivacggkpsvpvhf
dasv

SCOP Domain Coordinates for d1o0ga_:

Click to download the PDB-style file with coordinates for d1o0ga_.
(The format of our PDB-style files is described here.)

Timeline for d1o0ga_:

  • d1o0ga_ is new in SCOP 1.65
  • d1o0ga_ became obsolete in SCOP 1.67