SCOP 1.69: Domain d1nzta2: 1nzt A:128-282

Lineage for d1nzta2 (1nzt A:128-282)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (11 families)

5. Family d.14.1.7: UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89827] (1 protein)
   duplication; there are two structural repeats of this fold; each repeat is elaborated with additional structures forming the active site

6. Protein UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC [89828] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [89829] (2 PDB entries)

8. Domain d1nzta2: 1nzt A:128-282 [86456]

Details for d1nzta2

PDB Entry: 1nzt

PDB Description: Solution Structure of the LpxC Deacetylase of Lipid A Biosynthesis from Aquifex aeolicus with a Bound Substrate-Analog Inhibitor, TU-514

SCOP Domain Sequences for d1nzta2:

Sequence; same for both SEQRES and ATOM records:

>d1nzta2 d.14.1.7 (A:128-282) UDP-3-O-[3-hydroxymyristoyl] N-acetylglucosamine deacetylase LpxC {Aquifex aeolicus}
epiivedegrlikaepsdtlevtyegefknflgrqkftfvegneeeivlartfcfdweie
hikkvglgkggslkntlvlgkdkvynpeglryenepvrhkvfdligdlyllgspvkgkfy
sfrgghslnvklvkelakkqkltrdlphlpsvqal

Timeline for d1nzta2:

• d1nzta2 first appeared in SCOP 1.65
  
• d1nzta2 appears in SCOP 1.67
  
• d1nzta2 does not appear in SCOP 1.71