SCOPe 2.06: Domain d1nzib1: 1nzi B:3-117

Lineage for d1nzib1 (1nzi B:3-117)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.23: CUB-like [49853] (3 superfamilies)
   sandwich, 10 strands in 2 sheets; jelly-roll

4. Superfamily b.23.1: Spermadhesin, CUB domain [49854] (2 families)
   automatically mapped to Pfam PF00431

5. Family b.23.1.1: Spermadhesin, CUB domain [49855] (6 proteins)

6. Protein Complement C1S component [89258] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89259] (3 PDB entries)

8. Domain d1nzib1: 1nzi B:3-117 [86451]
   Other proteins in same PDB: d1nzia2, d1nzib2
   complexed with ca, mg

Details for d1nzib1

PDB Entry: 1nzi, 1.5 Å

PDB Description: Crystal Structure of the CUB1-EGF Interaction Domain of Complement Protease C1s

PDB Compounds: (B:) Complement C1s component

SCOPe Domain Sequences for d1nzib1:

Sequence, based on SEQRES records:

>d1nzib1 b.23.1.1 (B:3-117) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]}
tmygeilspnypqaypsevekswdievpegygihlyfthldielsencaydsvqiisgdt
eegrlcgqrssnnphspiveefqvpynklqvifksdfsneerftgfaayyvatdi

Sequence, based on observed residues (ATOM records):

>d1nzib1 b.23.1.1 (B:3-117) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]}
tmygeilspnypqaypsevekswdievpegygihlyfthldielsencaydsvqiisgdt
eegrlcgqrssnphspiveefqvpynklqvifksdfsneerftgfaayyvatdi

Timeline for d1nzib1:

• d1nzib1 first appeared in SCOP 1.65
  
• d1nzib1 appears in SCOPe 2.05
  
• d1nzib1 appears in SCOPe 2.07
  
• d1nzib1 appears in the current release, SCOPe 2.08