SCOP 1.69: Domain d1nz0b_: 1nz0 B:

Lineage for d1nz0b_ (1nz0 B:)

1. Root: SCOP 1.69

2. Class d: Alpha and beta proteins (a+b) [53931] (279 folds)

3. Fold d.14: Ribosomal protein S5 domain 2-like [54210] (1 superfamily)
   core: beta(3)-alpha-beta-alpha; 2 layers: alpha/beta; left-handed crossover

4. Superfamily d.14.1: Ribosomal protein S5 domain 2-like [54211] (11 families)

5. Family d.14.1.2: RNase P protein [54220] (1 protein)

6. Protein RNase P protein [54221] (3 species)

7. Species Thermotoga maritima [TaxId:243274] [89821] (1 PDB entry)

8. Domain d1nz0b_: 1nz0 B: [86434]

Details for d1nz0b_

PDB Entry: 1nz0, 1.2 Å

PDB Description: rnase p protein from thermotoga maritima

SCOP Domain Sequences for d1nz0b_:

Sequence; same for both SEQRES and ATOM records:

>d1nz0b_ d.14.1.2 (B:) RNase P protein {Thermotoga maritima}
rerlrlrrdfllifkegkslqneyfvvlfrkngmdysrlgivvkrkfgkatrrnklkrwv
reifrrnkgvipkgfdivviprkklseefervdfwtvrekllnllkrieg

Timeline for d1nz0b_:

• d1nz0b_ first appeared in SCOP 1.65
  
• d1nz0b_ appears in SCOP 1.67
  
• d1nz0b_ appears in SCOP 1.71
  
• d1nz0b_ appears in the current release, SCOPe 2.08