SCOPe 2.06: Domain d1nyua_: 1nyu A:

Lineage for d1nyua_ (1nyu A:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.7: Snake toxin-like [57301] (1 superfamily)
   disulfide-rich fold: nearly all-beta

4. Superfamily g.7.1: Snake toxin-like [57302] (4 families)

5. Family g.7.1.3: Extracellular domain of cell surface receptors [57354] (6 proteins)

6. Protein Type II activin receptor [57357] (3 species)

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [90154] (2 PDB entries)

8. Domain d1nyua_: 1nyu A: [86425]
   Other proteins in same PDB: d1nyub_, d1nyud_
   complexed with activin A

Details for d1nyua_

PDB Entry: 1nyu, 3.1 Å

PDB Description: crystal structure of activin a bound to the ecd of actriib

PDB Compounds: (A:) activin receptor

SCOPe Domain Sequences for d1nyua_:

Sequence, based on SEQRES records:

>d1nyua_ g.7.1.3 (A:) Type II activin receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
treciyynanwelertnqsglercegeqdkrlhcyaswrnssgtielvkkgcwlddfncy
drqecvateenpqvyfcccegnfcnerfthlpe

Sequence, based on observed residues (ATOM records):

>d1nyua_ g.7.1.3 (A:) Type II activin receptor {Norway rat (Rattus norvegicus) [TaxId: 10116]}
treciyynanwelertnqslercegeqdkrlhcyaswrnssgtielvkkgcwlddfncyd
rqecvateenpqvyfcccegnfcnerfthlpe

Timeline for d1nyua_:

• d1nyua_ first appeared in SCOP 1.65
  
• d1nyua_ appears in SCOPe 2.05
  
• d1nyua_ appears in SCOPe 2.07
  
• d1nyua_ appears in the current release, SCOPe 2.08