SCOPe 2.06: Domain d1nytc1: 1nyt C:102-269

Lineage for d1nytc1 (1nyt C:102-269)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.7: Aminoacid dehydrogenase-like, C-terminal domain [51883] (12 proteins)
   extra N-terminal helix displaces the C-terminal helix (following strand 6) from its usual position creating a family nicotineamide-binding site

6. Protein Shikimate 5-dehydrogenase AroE [89538] (6 species)

7. Species Escherichia coli [TaxId:562] [89539] (1 PDB entry)

8. Domain d1nytc1: 1nyt C:102-269 [86421]
   Other proteins in same PDB: d1nyta2, d1nytb2, d1nytc2, d1nytd2
   complexed with dtv, nap, so4

Details for d1nytc1

PDB Entry: 1nyt, 1.5 Å

PDB Description: shikimate dehydrogenase aroe complexed with nadp+

PDB Compounds: (C:) Shikimate 5-dehydrogenase

SCOPe Domain Sequences for d1nytc1:

Sequence; same for both SEQRES and ATOM records:

>d1nytc1 c.2.1.7 (C:102-269) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]}
dgvgllsdlerlsfirpglrilligaggasrgvllpllsldcavtitnrtvsraeelakl
fahtgsiqalsmdeleghefdliinatssgisgdipaipsslihpgiycydmfyqkgktp
flawceqrgskrnadglgmlvaqaahafllwhgvlpdvepvikqlqee

Timeline for d1nytc1:

• d1nytc1 first appeared in SCOP 1.65
  
• d1nytc1 appears in SCOPe 2.05
  
• d1nytc1 appears in SCOPe 2.07
  
• d1nytc1 appears in the current release, SCOPe 2.08