Lineage for d1nytb2 (1nyt B:1-101)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 998236Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 998237Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 998463Family c.58.1.5: Shikimate dehydrogenase-like [82336] (3 proteins)
  6. 998472Protein Shikimate 5-dehydrogenase AroE [89584] (3 species)
  7. 998473Species Escherichia coli [TaxId:562] [89585] (1 PDB entry)
  8. 998475Domain d1nytb2: 1nyt B:1-101 [86420]
    Other proteins in same PDB: d1nyta1, d1nytb1, d1nytc1, d1nytd1
    complexed with dtv, nap, so4

Details for d1nytb2

PDB Entry: 1nyt (more details), 1.5 Å

PDB Description: shikimate dehydrogenase aroe complexed with nadp+
PDB Compounds: (B:) Shikimate 5-dehydrogenase

SCOPe Domain Sequences for d1nytb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nytb2 c.58.1.5 (B:1-101) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]}
metyavfgnpiahskspfihqqfaqqlniehpygrvlapindfintlnaffsaggkganv
tvpfkeeafaradelteraalagavntlmrledgrllgdnt

SCOPe Domain Coordinates for d1nytb2:

Click to download the PDB-style file with coordinates for d1nytb2.
(The format of our PDB-style files is described here.)

Timeline for d1nytb2: