Lineage for d1nykb_ (1nyk B:)

  1. Root: SCOP 1.69
  2. 450777Class b: All beta proteins [48724] (144 folds)
  3. 461110Fold b.33: ISP domain [50021] (1 superfamily)
    consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8)
  4. 461111Superfamily b.33.1: ISP domain [50022] (2 families) (S)
  5. 461112Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (8 proteins)
  6. 461164Protein Soluble Rieske protein [89291] (1 species)
  7. 461165Species Thermus thermophilus [TaxId:274] [89292] (1 PDB entry)
  8. 461167Domain d1nykb_: 1nyk B: [86409]

Details for d1nykb_

PDB Entry: 1nyk (more details), 1.31 Å

PDB Description: Crystal Structure of the Rieske protein from Thermus thermophilus

SCOP Domain Sequences for d1nykb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nykb_ b.33.1.1 (B:) Soluble Rieske protein {Thermus thermophilus}
tpekeplkpgdilvyaqgggepkpirleelkpgdpfvlaypmdpktkvvksgeakntllv
arfdpeelapevaqhaaegvvaysavcthlgcivsqwvadeeaalcpchggvydlrhgaq
viagppprpvpqlpvrvedgvlvaageflgpvgvqa

SCOP Domain Coordinates for d1nykb_:

Click to download the PDB-style file with coordinates for d1nykb_.
(The format of our PDB-style files is described here.)

Timeline for d1nykb_: