![]() | Class b: All beta proteins [48724] (144 folds) |
![]() | Fold b.33: ISP domain [50021] (1 superfamily) consists of two all-beta subdomains: conserved small domain has a rubredoxin-like fold; larger domain consists of 6 beta-stands packed in either sandwich of two 3-stranded sheets or closed barrel (n=6; S=8) |
![]() | Superfamily b.33.1: ISP domain [50022] (2 families) ![]() |
![]() | Family b.33.1.1: Rieske iron-sulfur protein (ISP) [50023] (8 proteins) |
![]() | Protein Soluble Rieske protein [89291] (1 species) |
![]() | Species Thermus thermophilus [TaxId:274] [89292] (1 PDB entry) |
![]() | Domain d1nyka_: 1nyk A: [86408] |
PDB Entry: 1nyk (more details), 1.31 Å
SCOP Domain Sequences for d1nyka_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nyka_ b.33.1.1 (A:) Soluble Rieske protein {Thermus thermophilus} tpekeplkpgdilvyaqgggepkpirleelkpgdpfvlaypmdpktkvvksgeakntllv arfdpeelapevaqhaaegvvaysavcthlgcivsqwvadeeaalcpchggvydlrhgaq viagppprpvpqlpvrvedgvlvaageflgpvgvqa
Timeline for d1nyka_: