Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
Superfamily c.116.1: alpha/beta knot [75217] (9 families) known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
Family c.116.1.5: YggJ C-terminal domain-like [89632] (4 proteins) contains extra strand (3) in the parallel beta-sheet, order 321546; similar dimerisation to the MTH1 domain |
Protein Hypothetical protein HI0303 [89633] (1 species) |
Species Haemophilus influenzae [TaxId:727] [89634] (2 PDB entries) |
Domain d1nxzb2: 1nxz B:74-245 [86394] Other proteins in same PDB: d1nxza1, d1nxza3, d1nxzb1, d1nxzb3 structural genomics |
PDB Entry: 1nxz (more details), 2 Å
SCOPe Domain Sequences for d1nxzb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nxzb2 c.116.1.5 (B:74-245) Hypothetical protein HI0303 {Haemophilus influenzae [TaxId: 727]} keshlkihlgqvisrgermeftiqksvelgvnvitplwsercgvkldaermdkkiqqwqk iaiaaceqcgrnivpeirplmklqdwcaendgalklnlhprahysiktlptipaggvrll igsegglsaqeiaqteqqgfteillgkrvlrtetaslaaisalqicfgdlge
Timeline for d1nxzb2: