Lineage for d1nxzb1 (1nxz B:2-73)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2432833Fold b.122: PUA domain-like [88696] (1 superfamily)
    pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other
  4. 2432834Superfamily b.122.1: PUA domain-like [88697] (14 families) (S)
  5. 2432886Family b.122.1.2: YggJ N-terminal domain-like [89451] (3 proteins)
  6. 2432887Protein Hypothetical protein HI0303 [89452] (1 species)
  7. 2432888Species Haemophilus influenzae [TaxId:727] [89453] (2 PDB entries)
  8. 2432890Domain d1nxzb1: 1nxz B:2-73 [86393]
    Other proteins in same PDB: d1nxza2, d1nxza3, d1nxzb2, d1nxzb3
    structural genomics

Details for d1nxzb1

PDB Entry: 1nxz (more details), 2 Å

PDB Description: X-Ray Crystal Structure of Protein yggj_haein of Haemophilus influenzae. Northeast Structural Genomics Consortium Target IR73.
PDB Compounds: (B:) Hypothetical protein HI0303

SCOPe Domain Sequences for d1nxzb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nxzb1 b.122.1.2 (B:2-73) Hypothetical protein HI0303 {Haemophilus influenzae [TaxId: 727]}
ripriyhpislenqtqcylsedaanhvarvlrmtegeqlelfdgsnhiypakiiesnkks
vkveilgrelad

SCOPe Domain Coordinates for d1nxzb1:

Click to download the PDB-style file with coordinates for d1nxzb1.
(The format of our PDB-style files is described here.)

Timeline for d1nxzb1: