| Class b: All beta proteins [48724] (126 folds) |
| Fold b.122: PUA domain-like [88696] (1 superfamily) pseudobarrel; mixed folded sheet of 5 strands; order 13452; strand 1 and 3 are parallel to each other |
Superfamily b.122.1: PUA domain-like [88697] (3 families) ![]() |
| Family b.122.1.2: YggJ N-terminal domain-like [89451] (1 protein) |
| Protein Hypothetical protein HI0303 [89452] (1 species) |
| Species Haemophilus influenzae [TaxId:727] [89453] (1 PDB entry) |
| Domain d1nxzb1: 1nxz B:2-73 [86393] Other proteins in same PDB: d1nxza2, d1nxzb2 structural genomics complexed with mse |
PDB Entry: 1nxz (more details), 2 Å
SCOP Domain Sequences for d1nxzb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nxzb1 b.122.1.2 (B:2-73) Hypothetical protein HI0303 {Haemophilus influenzae}
ripriyhpislenqtqcylsedaanhvarvlrmtegeqlelfdgsnhiypakiiesnkks
vkveilgrelad
Timeline for d1nxzb1: