| Class c: Alpha and beta proteins (a/b) [51349] (121 folds) |
| Fold c.116: alpha/beta knot [75216] (1 superfamily) core: 3 layers: a/b/a, parallel beta-sheet of 5 strands, order 21435; contains a deep trefoil knot |
Superfamily c.116.1: alpha/beta knot [75217] (5 families) ![]() known or predicted SAM-dependent methytransferases including the SPOUT 'sequence' superfamily all known members have dimeric structures |
| Family c.116.1.5: YggJ C-terminal domain-like [89632] (1 protein) contains extra strand (3) in the parallel beta-sheet, order 321546; similar dimerisation to the MTH1 domain |
| Protein Hypothetical protein HI0303 [89633] (1 species) |
| Species Haemophilus influenzae [TaxId:727] [89634] (1 PDB entry) |
| Domain d1nxza2: 1nxz A:74-247 [86392] Other proteins in same PDB: d1nxza1, d1nxzb1 |
PDB Entry: 1nxz (more details), 2 Å
SCOP Domain Sequences for d1nxza2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nxza2 c.116.1.5 (A:74-247) Hypothetical protein HI0303 {Haemophilus influenzae}
keshlkihlgqvisrgermeftiqksvelgvnvitplwsercgvkldaermdkkiqqwqk
iaiaaceqcgrnivpeirplmklqdwcaendgalklnlhprahysiktlptipaggvrll
igsegglsaqeiaqteqqgfteillgkrvlrtetaslaaisalqicfgdlgeaa
Timeline for d1nxza2: