Lineage for d1nxub1 (1nxu B:1-332)

  1. Root: SCOPe 2.06
  2. 2089713Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2169228Fold c.122: L-sulfolactate dehydrogenase-like [89732] (1 superfamily)
    core: 3 layers, a/b/a; mixed sheet of 7 strands, order 1237456; strands 1, 6 and 7 are antiparallel to the rest
  4. 2169229Superfamily c.122.1: L-sulfolactate dehydrogenase-like [89733] (2 families) (S)
    topological similarity to the domain 2 of TM1585
    automatically mapped to Pfam PF02615
  5. 2169230Family c.122.1.1: L-sulfolactate dehydrogenase-like [89734] (4 proteins)
    Pfam PF02615; type II malate/L-lactate dehydrogenase;
  6. 2169231Protein 2,3-diketogulonate oxidoreductase (YiaK) [89735] (1 species)
  7. 2169232Species Escherichia coli [TaxId:562] [89736] (2 PDB entries)
  8. 2169234Domain d1nxub1: 1nxu B:1-332 [86390]
    Other proteins in same PDB: d1nxub2
    structural genomics
    complexed with so4

Details for d1nxub1

PDB Entry: 1nxu (more details), 1.8 Å

PDB Description: crystal structure of e. coli hypothetical oxidoreductase yiak northeast structural genomics consortium target er82.
PDB Compounds: (B:) Hypothetical oxidoreductase yiaK

SCOPe Domain Sequences for d1nxub1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nxub1 c.122.1.1 (B:1-332) 2,3-diketogulonate oxidoreductase (YiaK) {Escherichia coli [TaxId: 562]}
mkvtfeqlkaafnrvlisrgvdsetadacaemfarttesgvyshgvnrfprfiqqlengd
iipdaqpkritslgaieqwdaqrsignltakkmmdraielaadhgiglvalrnanhwmrg
gsygwqaaekgyigicwtnsiavmppwgakecrigtnplivaipstpitmvdmsmsmfsy
gmlevnrlagrqlpvdggfddegnltkepgvieknrrilpmgywkgsgmsivldmiatll
sdgasvaevtqdnsdeygisqifiaievdklidgptrdaklqrimdyvtsaeradenqai
rlpghefttllaenrrngitvddsvwakiqal

SCOPe Domain Coordinates for d1nxub1:

Click to download the PDB-style file with coordinates for d1nxub1.
(The format of our PDB-style files is described here.)

Timeline for d1nxub1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nxub2
View in 3D
Domains from other chains:
(mouse over for more information)
d1nxua_