Lineage for d1nxqa_ (1nxq A:)

  1. Root: SCOP 1.73
  2. 681097Class c: Alpha and beta proteins (a/b) [51349] (141 folds)
  3. 685975Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 685976Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (12 families) (S)
  5. 686289Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (70 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7
  6. 687057Protein R-specific alcohol dehydrogenase [89521] (1 species)
  7. 687058Species Lactobacillus brevis [TaxId:1580] [89522] (8 PDB entries)
  8. 687063Domain d1nxqa_: 1nxq A: [86388]
    complexed with mg

Details for d1nxqa_

PDB Entry: 1nxq (more details), 1.79 Å

PDB Description: Crystal Structure of R-alcohol dehydrogenase (RADH) (apoenyzme) from Lactobacillus brevis
PDB Compounds: (A:) R-alcohol dehydrogenase

SCOP Domain Sequences for d1nxqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nxqa_ c.2.1.2 (A:) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]}
snrldgkvaiitggtlgiglaiatkfveegakvmitgrhsdvgekaaksvgtpdqiqffq
hdssdedgwtklfdatekafgpvstlvnnagiavnksveetttaewrkllavnldgvffg
trlgiqrmknkglgasiinmssiegfvgdpslgaynaskgavrimsksaaldcalkdydv
rvntvhpgyiktplvddlpgaeeamsqrtktpmghigepndiayicvylasneskfatgs
efvvdggytaq

SCOP Domain Coordinates for d1nxqa_:

Click to download the PDB-style file with coordinates for d1nxqa_.
(The format of our PDB-style files is described here.)

Timeline for d1nxqa_: