Lineage for d1nwyc_ (1nwy C:)

  1. Root: SCOPe 2.02
  2. 1248417Class i: Low resolution protein structures [58117] (25 folds)
  3. 1248418Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1248419Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1249271Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1249272Protein 50S subunit [58125] (6 species)
  7. 1249275Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)
  8. 1249350Domain d1nwyc_: 1nwy C: [86347]
    CA-atoms only for the ribosomal protein structures
    complexed with zit

Details for d1nwyc_

PDB Entry: 1nwy (more details), 3.3 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with azithromycin
PDB Compounds: (C:) ribosomal protein l4

SCOPe Domain Sequences for d1nwyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwyc_ i.1.1.2 (C:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]}
aqinvigqnggrtielplpevnsgvlhevvtwqlasrrrgtastrtraqvsktgrkmygq
kgtgnarhgdrsvptfvgggvafgpkprsydytlprqvrqlglamaiasrqeggklvavd
gfdiadaktknfiswakqngldgtekvllvtddentrraarnvswvsvlpvagvnvydil
rhdrlvidaaaleivee

SCOPe Domain Coordinates for d1nwyc_:

Click to download the PDB-style file with coordinates for d1nwyc_.
(The format of our PDB-style files is described here.)

Timeline for d1nwyc_: