SCOPe 2.04: Domain d1nwya_: 1nwy A:

Lineage for d1nwya_ (1nwy A:)

1. Root: SCOPe 2.04

2. Class i: Low resolution protein structures [58117] (25 folds)

3. Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)

4. Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families)

5. Family i.1.1.2: Large subunit [58124] (1 protein)

6. Protein 50S subunit [58125] (6 species)

7. Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)

8. Domain d1nwya_: 1nwy A: [86345]
   CA-atoms only for the ribosomal protein structures
   complexed with zit

Details for d1nwya_

PDB Entry: 1nwy, 3.3 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with azithromycin

PDB Compounds: (A:) ribosomal protein l2

SCOPe Domain Sequences for d1nwya_:

Sequence; same for both SEQRES and ATOM records:

>d1nwya_ i.1.1.2 (A:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]}
kkyrpytpsrrqmttadfsgltkkrpekaltealpktggrnnrgritsrfiggghkrlyr
iidfkrrdksgvnakvaaieydpnrsariallhyadgekryilapegltvgatvnagpea
epklgnalplrfvpvgavvhalelvpgkgaqlarsagtsvqvqgkesdyvivrlpsgelr
rvhsecyatigavgnaehknivlgkagrsrwlgrkphqrgsamnpvdhphgggegrtgag
rvpvtpwgkptkglktrrkrktsdrfivtr

Timeline for d1nwya_:

• d1nwya_ first appeared in SCOP 1.65
  
• d1nwya_ appears in SCOPe 2.03
  
• d1nwya_ appears in SCOPe 2.05
  
• d1nwya_ appears in the current release, SCOPe 2.08