Class i: Low resolution protein structures [58117] (25 folds) |
Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily) |
Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) |
Family i.1.1.2: Large subunit [58124] (1 protein) |
Protein 50S subunit [58125] (6 species) |
Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries) |
Domain d1nwxy_: 1nwx Y: [86337] CA-atoms only for the ribosomal protein structures complexed with 773 |
PDB Entry: 1nwx (more details), 3.5 Å
SCOPe Domain Sequences for d1nwxy_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nwxy_ i.1.1.2 (Y:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]} mqkdlhpkavpckiiyqgqvvmetmstrpeihvdvwsgvhpfwtgeerfldtegrvdkfn krfgdsyrrgskk
Timeline for d1nwxy_:
View in 3D Domains from other chains: (mouse over for more information) d1nwx1_, d1nwx2_, d1nwx3_, d1nwx4_, d1nwxa_, d1nwxb_, d1nwxc_, d1nwxd_, d1nwxe_, d1nwxf_, d1nwxg_, d1nwxh_, d1nwxi_, d1nwxj_, d1nwxk_, d1nwxl_, d1nwxm_, d1nwxn_, d1nwxo_, d1nwxp_, d1nwxq_, d1nwxr_, d1nwxs_, d1nwxt_, d1nwxu_, d1nwxw_, d1nwxx_, d1nwxz_ |