Lineage for d1nwxh_ (1nwx H:)

  1. Root: SCOPe 2.03
  2. 1467789Class i: Low resolution protein structures [58117] (25 folds)
  3. 1467790Fold i.1: Ribosome and ribosomal fragments [58118] (1 superfamily)
  4. 1467791Superfamily i.1.1: Ribosome and ribosomal fragments [58119] (3 families) (S)
  5. 1468643Family i.1.1.2: Large subunit [58124] (1 protein)
  6. 1468644Protein 50S subunit [58125] (6 species)
  7. 1468645Species Deinococcus radiodurans [TaxId:1299] [69993] (12 PDB entries)
  8. 1468763Domain d1nwxh_: 1nwx H: [86321]
    CA-atoms only for the ribosomal protein structures
    complexed with 773

Details for d1nwxh_

PDB Entry: 1nwx (more details), 3.5 Å

PDB Description: complex of the large ribosomal subunit from deinococcus radiodurans with abt-773
PDB Compounds: (H:) ribosomal protein l13

SCOPe Domain Sequences for d1nwxh_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwxh_ i.1.1.2 (H:) 50S subunit {Deinococcus radiodurans [TaxId: 1299]}
vktyipkndeqnwvvvdasgvplgrlatliasrirgkhrpdftpnmiqgdfvvvinaaqv
altgkklddkvytrytgyqgglktetarealskhperviehavfgmlpkgrqgramhtrl
kvyagethphsaqkpqvlktqpl

SCOPe Domain Coordinates for d1nwxh_:

Click to download the PDB-style file with coordinates for d1nwxh_.
(The format of our PDB-style files is described here.)

Timeline for d1nwxh_: