Lineage for d1nwwb_ (1nww B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1196747Fold d.17: Cystatin-like [54402] (7 superfamilies)
    Core: alpha-beta(4); helix packs against coiled antiparallel beta-sheet
  4. 1197160Superfamily d.17.4: NTF2-like [54427] (31 families) (S)
    has a beta-alpha(2)-beta insertion after the main helix
  5. 1197572Family d.17.4.8: Limonene-1,2-epoxide hydrolase-like [89854] (3 proteins)
  6. 1197573Protein Limonene-1,2-epoxide hydrolase [89855] (1 species)
  7. 1197574Species Rhodococcus erythropolis [TaxId:1833] [89856] (2 PDB entries)
  8. 1197576Domain d1nwwb_: 1nww B: [86307]
    complexed with hpn, mes

Details for d1nwwb_

PDB Entry: 1nww (more details), 1.2 Å

PDB Description: limonene-1,2-epoxide hydrolase
PDB Compounds: (B:) limonene-1,2-epoxide hydrolase

SCOPe Domain Sequences for d1nwwb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwwb_ d.17.4.8 (B:) Limonene-1,2-epoxide hydrolase {Rhodococcus erythropolis [TaxId: 1833]}
kieqprwaskdsaagaastpdekivlefmdaltsndaaklieyfaedtmyqnmplppayg
rdaveqtlaglftvmsidavetfhigssnglvytervdvlralptgksynlsilgvfqlt
egkitgwrdyfdlrefeeavdlplrg

SCOPe Domain Coordinates for d1nwwb_:

Click to download the PDB-style file with coordinates for d1nwwb_.
(The format of our PDB-style files is described here.)

Timeline for d1nwwb_: