SCOP 1.75: Domain d1nwmx_: 1nwm X:

Lineage for d1nwmx_ (1nwm X:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.7: Spectrin repeat-like [46965] (16 superfamilies)
   3 helices; bundle, closed, left-handed twist; up-and-down

4. Superfamily a.7.8: GAT-like domain [89009] (2 families)

5. Family a.7.8.1: GAT domain [89010] (3 proteins)
   this is a repeat family; one repeat unit is 1yd8 G:208-299 found in domain

6. Protein ADP-ribosylation factor binding protein Gga1 [89011] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [89012] (6 PDB entries)
   Uniprot Q9UJY5 211-299

8. Domain d1nwmx_: 1nwm X: [86301]

Details for d1nwmx_

PDB Entry: 1nwm, 2.4 Å

PDB Description: GAT domain of human GGA1

PDB Compounds: (X:) ADP-ribosylation factor binding protein GGA1

SCOP Domain Sequences for d1nwmx_:

Sequence, based on SEQRES records:

>d1nwmx_ a.7.8.1 (X:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]}
lraanklikemvqedqkrmekiskrvnaieevnnnvklltemvmshsqggaaagssedlm
kelyqrcermrptlfrlasdtedndealaeilqandnltqvinlykqlvrge

Sequence, based on observed residues (ATOM records):

>d1nwmx_ a.7.8.1 (X:) ADP-ribosylation factor binding protein Gga1 {Human (Homo sapiens) [TaxId: 9606]}
lraanklikemvqedqkrmekiskrvnaieevnnnvklltemvmshsssedlmkelyqrc
ermrptlfrlasdtedndealaeilqandnltqvinlykqlvrge

Timeline for d1nwmx_:

• d1nwmx_ first appeared in SCOP 1.65
  
• d1nwmx_ appears in SCOP 1.73
  
• d1nwmx_ appears in SCOPe 2.01
  
• d1nwmx_ appears in the current release, SCOPe 2.08