Lineage for d1nwea_ (1nwe A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 315136Fold c.45: (Phosphotyrosine protein) phosphatases II [52798] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 4 strands, order 1432
  4. 315137Superfamily c.45.1: (Phosphotyrosine protein) phosphatases II [52799] (2 families) (S)
    share with the family I the common active site structure with a circularly permuted topology
  5. 315174Family c.45.1.2: Higher-molecular-weight phosphotyrosine protein phosphatases [52805] (3 proteins)
    has an extension to the beta-sheet of 3 antiparallel strands before strand 4
  6. 315185Protein Tyrosine phosphatase [52806] (8 species)
  7. 315186Species Human (Homo sapiens), 1B [TaxId:9606] [52807] (48 PDB entries)
  8. 315238Domain d1nwea_: 1nwe A: [86298]
    complexed with fg1; mutant

Details for d1nwea_

PDB Entry: 1nwe (more details), 3.1 Å

PDB Description: ptp1b r47c modified at c47 with n-[4-(2-{2-[3-(2-bromo-acetylamino)- propionylamino]-3-hydroxy-propionylamino}-ethyl)-phenyl]-oxalamic acid
PDB Compounds: (A:)

SCOP Domain Sequences for d1nwea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nwea_ c.45.1.2 (A:) Tyrosine phosphatase {Human (Homo sapiens), 1B}
emekefeqidksgswaaiyqdirheasdfpsrvaklpknknrnrycdvspfdhsriklhq
edndyinaslikmeeaqrsyiltqgplpntvghfwemvweqksrgvvmlnrvmekgslkc
aqywpqkeekemifedtnlkltlisediksyytvrqlelenlttqetreilhfhyttwpd
fgvpespasflnflfkvresgslspehgpvvvhcsagigrsgtfcladtclllmdkrkdp
ssvdikkvllemrkfrmgliqtadqlrfsylaviegakfimgdssvqdqwkelshe

SCOP Domain Coordinates for d1nwea_:

Click to download the PDB-style file with coordinates for d1nwea_.
(The format of our PDB-style files is described here.)

Timeline for d1nwea_: