Lineage for d1nvmg2 (1nvm G:3-290)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 305036Fold c.1: TIM beta/alpha-barrel [51350] (26 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 306689Superfamily c.1.10: Aldolase [51569] (5 families) (S)
    Common fold covers whole protein structure
  5. 306995Family c.1.10.5: 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain [89494] (1 protein)
  6. 306996Protein 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain [89495] (1 species)
  7. 306997Species Pseudomonas sp. [TaxId:306] [89496] (1 PDB entry)
    gene product DmpG
  8. 307001Domain d1nvmg2: 1nvm G:3-290 [86262]
    Other proteins in same PDB: d1nvma1, d1nvmb1, d1nvmb2, d1nvmc1, d1nvmd1, d1nvmd2, d1nvme1, d1nvmf1, d1nvmf2, d1nvmg1, d1nvmh1, d1nvmh2
    complexed with mn, mpd, nad, oxl, sul

Details for d1nvmg2

PDB Entry: 1nvm (more details), 1.7 Å

PDB Description: crystal structure of a bifunctional aldolase-dehydrogenase : sequestering a reactive and volatile intermediate
PDB Compounds: (G:)

SCOP Domain Sequences for d1nvmg2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nvmg2 c.1.10.5 (G:3-290) 4-hydroxy-2-oxovalerate aldolase DmpG, catalytic domain {Pseudomonas sp.}
fnpskklyisdvtlrdgshairhqytlddvraiaraldkakvdsievahgdglqgssfny
gfgrhtdleyieavageishaqiatlllpgigsvhdlknayqagarvvrvathcteadvs
kqhieyarnlgmdtvgflmmshmipaeklaeqgklmesygatciymadsggamsmndird
rmrafkavlkpetqvgmhahhnlslgvansivaveegcdrvdaslagmgagagnaplevf
iavaerlgwnhgtdlytlmdaaddivrplqdrpvrvdretlglgyagv

SCOP Domain Coordinates for d1nvmg2:

Click to download the PDB-style file with coordinates for d1nvmg2.
(The format of our PDB-style files is described here.)

Timeline for d1nvmg2: