Lineage for d1nvha_ (1nvh A:)

  1. Root: SCOP 1.65
  2. 341323Class g: Small proteins [56992] (66 folds)
  3. 344238Fold g.41: Rubredoxin-like [57769] (12 superfamilies)
    metal(zinc or iron)-bound fold; sequence contains two CX(n)C motifs, in most cases n = 2
  4. 344467Superfamily g.41.8: Zn-binding ribosomal proteins [57829] (4 families) (S)
  5. 344513Family g.41.8.4: Ribosomal protein S27e [90217] (1 protein)
  6. 344514Protein Ribosomal protein S27e [90218] (1 species)
  7. 344515Species Archaeon Archaeoglobus fulgidus [TaxId:2234] [90219] (1 PDB entry)
  8. 344516Domain d1nvha_: 1nvh A: [86240]
    structural genomics; NESG target GR2

Details for d1nvha_

PDB Entry: 1nvh (more details)

PDB Description: Solution structure of 30S ribosomal protein S27e from Archaeoglobus fulgidus: GR2, a NESG Target protein

SCOP Domain Sequences for d1nvha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nvha_ g.41.8.4 (A:) Ribosomal protein S27e {Archaeon Archaeoglobus fulgidus}
mhsrfvkvkcpdceheqvifdhpstivkciicgrtvaeptggkgnikaeiieyvdqiele

SCOP Domain Coordinates for d1nvha_:

Click to download the PDB-style file with coordinates for d1nvha_.
(The format of our PDB-style files is described here.)

Timeline for d1nvha_:

  • d1nvha_ is new in SCOP 1.65
  • d1nvha_ became obsolete in SCOP 1.67