Lineage for d1nuqa_ (1nuq A:)

  1. Root: SCOP 1.65
  2. 305035Class c: Alpha and beta proteins (a/b) [51349] (121 folds)
  3. 312145Fold c.26: Adenine nucleotide alpha hydrolase-like [52373] (3 superfamilies)
    core: 3 layers, a/b/a ; parallel beta-sheet of 5 strands, order 32145
  4. 312146Superfamily c.26.1: Nucleotidylyl transferase [52374] (5 families) (S)
  5. 312272Family c.26.1.3: Adenylyltransferase [52397] (4 proteins)
  6. 312273Protein Cytosolic NMN/NAMN adenylyltransferase [89613] (1 species)
  7. 312274Species Human (Homo sapiens), FKSG76 [TaxId:9606] [89614] (6 PDB entries)
  8. 312281Domain d1nuqa_: 1nuq A: [86201]

Details for d1nuqa_

PDB Entry: 1nuq (more details), 1.9 Å

PDB Description: crystal structure of human cytosolic nmn/namn adenylyltransferase complexed with naad

SCOP Domain Sequences for d1nuqa_:

Sequence, based on SEQRES records: (download)

>d1nuqa_ c.26.1.3 (A:) Cytosolic NMN/NAMN adenylyltransferase {Human (Homo sapiens), FKSG76}
sripvvllacgsfnpitnmhlrmfevardhlhqtgmyqviqgiispvndtygkkdlaash
hrvamarlalqtsdwirvdpweseqaqwmetvkvlrhhhskllrsppqmegpdhgkalfs
tpaavpelkllcgadvlktfqtpnlwkdahiqeivekfglvcvgrvshdpkgyiaespil
rmhqhnihlakepvqneisatyirralgqgqsvkylipdavityikdhglytk

Sequence, based on observed residues (ATOM records): (download)

>d1nuqa_ c.26.1.3 (A:) Cytosolic NMN/NAMN adenylyltransferase {Human (Homo sapiens), FKSG76}
sripvvllacgsfnpitnmhlrmfevardhlhqtgmyqviqgiispvndtygkkdlaash
hrvamarlalqtsdwirvdpweseqaqwmetvkvlrhhhskllavpelkllcgadvlktf
qtpnlwkdahiqeivekfglvcvgrvshdpkgyiaespilrmhqhnihlakepvqneisa
tyirralgqgqsvkylipdavityikdhglytk

SCOP Domain Coordinates for d1nuqa_:

Click to download the PDB-style file with coordinates for d1nuqa_.
(The format of our PDB-style files is described here.)

Timeline for d1nuqa_: