Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (22 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.4: Transglutaminase core [54044] (2 proteins) |
Protein Transglutaminase catalytic domain [54045] (4 species) |
Species Human (Homo sapiens), TGase E3 [TaxId:9606] [75334] (8 PDB entries) |
Domain d1nugb4: 1nug B:141-459 [86193] Other proteins in same PDB: d1nuga1, d1nuga2, d1nuga3, d1nugb1, d1nugb2, d1nugb3 complexed with ca, cl, mg; mutant |
PDB Entry: 1nug (more details), 2.4 Å
SCOP Domain Sequences for d1nugb4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nugb4 d.3.1.4 (B:141-459) Transglutaminase catalytic domain {Human (Homo sapiens), TGase E3 [TaxId: 9606]} dsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqfeedilsiclsildrslnfrr daatdvasrndpkyvgrvlsaminsnddngvlagnwsgtytggrdprswdgsveilknwk ksglspvrygqcwvfagtlntalrslgipsrvitnfnsahdtdrnlsvdvyydpmgnpld kgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqersqgvfqcgpasvigvregdvq lnfdmpfifaevnadritwlydnttgkqwknsvnshtigryistkavgsnarmdvtdkyk ypegsdqerqvfqkalgkl
Timeline for d1nugb4:
View in 3D Domains from other chains: (mouse over for more information) d1nuga1, d1nuga2, d1nuga3, d1nuga4 |