SCOP 1.65: Domain d1nugb2: 1nug B:473-593

Lineage for d1nugb2 (1nug B:473-593)

1. Root: SCOP 1.65

2. Class b: All beta proteins [48724] (126 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family)

5. Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)

6. Protein Transglutaminase, two C-terminal domains [49311] (4 species)
   duplication

7. Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74850] (5 PDB entries)

8. Domain d1nugb2: 1nug B:473-593 [86191]
   Other proteins in same PDB: d1nuga1, d1nuga4, d1nugb1, d1nugb4

Details for d1nugb2

PDB Entry: 1nug, 2.4 Å

PDB Description: role of calcium ions in the activation and activity of the transglutaminase 3 enzyme (2 calciums, 1 mg, inactive form)

SCOP Domain Sequences for d1nugb2:

Sequence; same for both SEQRES and ATOM records:

>d1nugb2 b.1.5.1 (B:473-593) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3}
leteeqepsiigklkvagmlavgkevnlvlllknlsrdtktvtvnmtawtiiyngtlvhe
vwkdsatmsldpeeeaehpikisyaqyerylksdnmiritavckvpdesevvverdiild
n

Timeline for d1nugb2:

• d1nugb2 is new in SCOP 1.65
  
• d1nugb2 appears in SCOP 1.67
  
• d1nugb2 appears in the current release, SCOPe 2.08