Lineage for d1nuga2 (1nug A:479-593)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 788243Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family) (S)
  5. 788244Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 788245Protein Transglutaminase, two C-terminal domains [49311] (4 species)
    duplication
  7. 788279Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74850] (8 PDB entries)
  8. 788300Domain d1nuga2: 1nug A:479-593 [86187]
    Other proteins in same PDB: d1nuga1, d1nuga4, d1nugb1, d1nugb4

Details for d1nuga2

PDB Entry: 1nug (more details), 2.4 Å

PDB Description: role of calcium ions in the activation and activity of the transglutaminase 3 enzyme (2 calciums, 1 mg, inactive form)
PDB Compounds: (A:) Protein-glutamine glutamyltransferase E

SCOP Domain Sequences for d1nuga2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nuga2 b.1.5.1 (A:479-593) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
epsiigklkvagmlavgkevnlvlllknlsrdtktvtvnmtawtiiyngtlvhevwkdsa
tmsldpeeeaehpikisyaqyerylksdnmiritavckvpdesevvverdiildn

SCOP Domain Coordinates for d1nuga2:

Click to download the PDB-style file with coordinates for d1nuga2.
(The format of our PDB-style files is described here.)

Timeline for d1nuga2: