SCOP 1.75: Domain d1nufa4: 1nuf A:141-461

Lineage for d1nufa4 (1nuf A:141-461)

1. Root: SCOP 1.75

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.3: Cysteine proteinases [54000] (1 superfamily)
   consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn

4. Superfamily d.3.1: Cysteine proteinases [54001] (22 families)
   the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet

5. Family d.3.1.4: Transglutaminase core [54044] (2 proteins)

6. Protein Transglutaminase catalytic domain [54045] (4 species)

7. Species Human (Homo sapiens), TGase E3 [TaxId:9606] [75334] (8 PDB entries)

8. Domain d1nufa4: 1nuf A:141-461 [86185]
   Other proteins in same PDB: d1nufa1, d1nufa2, d1nufa3
   complexed with br, ca, cl; mutant

Details for d1nufa4

PDB Entry: 1nuf, 2.7 Å

PDB Description: role of calcium ions in the activation and activity of the transglutaminase 3 enzyme

PDB Compounds: (A:) Protein-glutamine glutamyltransferase E

SCOP Domain Sequences for d1nufa4:

Sequence; same for both SEQRES and ATOM records:

>d1nufa4 d.3.1.4 (A:141-461) Transglutaminase catalytic domain {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
dsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqfeedilsiclsildrslnfrr
daatdvasrndpkyvgrvlsaminsnddngvlagnwsgtytggrdprswdgsveilknwk
ksglspvrygqcwvfagtlntalrslgipsrvitnfnsahdtdrnlsvdvyydpmgnpld
kgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqersqgvfqcgpasvigvregdvq
lnfdmpfifaevnadritwlydnttgkqwknsvnshtigryistkavgsnarmdvtdkyk
ypegsdqerqvfqkalgklkp

Timeline for d1nufa4:

• d1nufa4 first appeared in SCOP 1.65
  
• d1nufa4 appears in SCOP 1.73
  
• d1nufa4 appears in SCOPe 2.01
  
• d1nufa4 appears in the current release, SCOPe 2.08