Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
Superfamily d.3.1: Cysteine proteinases [54001] (22 families) the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
Family d.3.1.4: Transglutaminase core [54044] (2 proteins) |
Protein Transglutaminase catalytic domain [54045] (4 species) |
Species Human (Homo sapiens), TGase E3 [TaxId:9606] [75334] (8 PDB entries) |
Domain d1nuda4: 1nud A:141-460 [86177] Other proteins in same PDB: d1nuda1, d1nuda2, d1nuda3, d1nudb1, d1nudb2, d1nudb3 |
PDB Entry: 1nud (more details), 2.7 Å
SCOP Domain Sequences for d1nuda4:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nuda4 d.3.1.4 (A:141-460) Transglutaminase catalytic domain {Human (Homo sapiens), TGase E3 [TaxId: 9606]} dsvfmgnhaereeyvqedagiifvgstnrigmigwnfgqfeedilsiclsildrslnfrr daatdvasrndpkyvgrvlsaminsnddngvlagnwsgtytggrdprswdgsveilknwk ksglspvrygqcwvfagtlntalrslgipsrvitnfnsahdtdrnlsvdvyydpmgnpld kgsdsvwnfhvwnegwfvrsdlgpsyggwqvldatpqersqgvfqcgpasvigvregdvq lnfdmpfifaevnadritwlydnttgkqwknsvnshtigryistkavgsnarmdvtdkyk ypegsdqerqvfqkalgklk
Timeline for d1nuda4:
View in 3D Domains from other chains: (mouse over for more information) d1nudb1, d1nudb2, d1nudb3, d1nudb4 |