Lineage for d1nuda3 (1nud A:594-692)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 367153Superfamily b.1.5: Transglutaminase, two C-terminal domains [49309] (1 family) (S)
  5. 367154Family b.1.5.1: Transglutaminase, two C-terminal domains [49310] (1 protein)
  6. 367155Protein Transglutaminase, two C-terminal domains [49311] (4 species)
    duplication
  7. 367189Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74850] (8 PDB entries)
  8. 367217Domain d1nuda3: 1nud A:594-692 [86176]
    Other proteins in same PDB: d1nuda1, d1nuda4, d1nudb1, d1nudb4

Details for d1nuda3

PDB Entry: 1nud (more details), 2.7 Å

PDB Description: Role of Calcium Ions in the Activation and Activity of the Transglutaminase 3 Enzyme (3 calciums, active form)

SCOP Domain Sequences for d1nuda3:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nuda3 b.1.5.1 (A:594-692) Transglutaminase, two C-terminal domains {Human (Homo sapiens), TGase E3}
ptltlevlnearvrkpvnvqmlfsnpldepvrdcvlmvegsglllgnlkidvptlgpker
srvrfdilpsrsgtkqlladfscnkfpaikamlsidvae

SCOP Domain Coordinates for d1nuda3:

Click to download the PDB-style file with coordinates for d1nuda3.
(The format of our PDB-style files is described here.)

Timeline for d1nuda3: