Lineage for d1nuda1 (1nud A:1-140)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 367734Superfamily b.1.18: E set domains [81296] (18 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 368074Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)
  6. 368075Protein Transglutaminase N-terminal domain [49235] (4 species)
    elaborated with many loop insertions in the common fold
  7. 368093Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74845] (8 PDB entries)
  8. 368107Domain d1nuda1: 1nud A:1-140 [86174]
    Other proteins in same PDB: d1nuda2, d1nuda3, d1nuda4, d1nudb2, d1nudb3, d1nudb4

Details for d1nuda1

PDB Entry: 1nud (more details), 2.7 Å

PDB Description: role of calcium ions in the activation and activity of the transglutaminase 3 enzyme (3 calciums, active form)

SCOP Domain Sequences for d1nuda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nuda1 b.1.18.9 (A:1-140) Transglutaminase N-terminal domain {Human (Homo sapiens), TGase E3}
aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
gissvklgtfillfnpwlnv

SCOP Domain Coordinates for d1nuda1:

Click to download the PDB-style file with coordinates for d1nuda1.
(The format of our PDB-style files is described here.)

Timeline for d1nuda1: