Lineage for d1nuda1 (1nud A:1-140)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2765063Superfamily b.1.18: E set domains [81296] (27 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 2765693Family b.1.18.9: Transglutaminase N-terminal domain [81289] (1 protein)
  6. 2765694Protein Transglutaminase N-terminal domain [49235] (4 species)
    elaborated with many loop insertions in the common fold
  7. 2765714Species Human (Homo sapiens), TGase E3 [TaxId:9606] [74845] (9 PDB entries)
  8. 2765730Domain d1nuda1: 1nud A:1-140 [86174]
    Other proteins in same PDB: d1nuda2, d1nuda3, d1nuda4, d1nudb2, d1nudb3, d1nudb4
    complexed with br, ca, cl

Details for d1nuda1

PDB Entry: 1nud (more details), 2.7 Å

PDB Description: role of calcium ions in the activation and activity of the transglutaminase 3 enzyme (3 calciums, active form)
PDB Compounds: (A:) Protein-glutamine glutamyltransferase E

SCOPe Domain Sequences for d1nuda1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nuda1 b.1.18.9 (A:1-140) Transglutaminase N-terminal domain {Human (Homo sapiens), TGase E3 [TaxId: 9606]}
aalgvqsinwqtafnrqahhtdkfssqelilrrgqnfqvlmimnkglgsnerlefivstg
pypsesamtkavfplsngssggwsavlqasngntltisisspasapigrytmalqifsqg
gissvklgtfillfnpwlnv

SCOPe Domain Coordinates for d1nuda1:

Click to download the PDB-style file with coordinates for d1nuda1.
(The format of our PDB-style files is described here.)

Timeline for d1nuda1: