![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
![]() | Superfamily b.40.4: Nucleic acid-binding proteins [50249] (17 families) ![]() |
![]() | Family b.40.4.4: Myf domain [50277] (7 proteins) |
![]() | Protein C-terminal domain of metazoan tyrosyl-tRNA synthetase, TyrRS [89326] (1 species) EMAP II-like domain found in vertebrata and insect enzymes; free domain possesses a cytokine activity |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89327] (1 PDB entry) |
![]() | Domain d1ntgc_: 1ntg C: [86166] |
PDB Entry: 1ntg (more details), 2.21 Å
SCOPe Domain Sequences for d1ntgc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ntgc_ b.40.4.4 (C:) C-terminal domain of metazoan tyrosyl-tRNA synthetase, TyrRS {Human (Homo sapiens) [TaxId: 9606]} peevipsrldirvgkiitvekhpdadslyvekidvgeaeprtvvsglvqfvpkeelqdrl vvvlcnlkpqkmrgvesqgmllcasieginrqvepldppagsapgehvfvkgyekgqpde elkpkkkvfeklqadfkiseeciaqwkqtnfmtklgsisckslkggnisle
Timeline for d1ntgc_: