Lineage for d1nt9j_ (1nt9 J:)

  1. Root: SCOP 1.67
  2. 432183Class i: Low resolution protein structures [58117] (22 folds)
  3. 433235Fold i.8: RNA polymerase [58180] (1 superfamily)
  4. 433236Superfamily i.8.1: RNA polymerase [58181] (1 family) (S)
  5. 433237Family i.8.1.1: RNA polymerase [58182] (2 proteins)
  6. 433238Protein Complete 12-subunit RNA polymerase II complex [90261] (1 species)
  7. 433239Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [90262] (5 PDB entries)
  8. 433262Domain d1nt9j_: 1nt9 J: [86160]

Details for d1nt9j_

PDB Entry: 1nt9 (more details), 4.2 Å

PDB Description: Complete 12-subunit RNA polymerase II

SCOP Domain Sequences for d1nt9j_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nt9j_ i.8.1.1 (J:) Complete 12-subunit RNA polymerase II complex {Baker's yeast (Saccharomyces cerevisiae)}
mivpvrcfscgkvvgdkwesylnllqedeldegtalsrlglkryccrrmilthvdliekf
lrynp

SCOP Domain Coordinates for d1nt9j_:

Click to download the PDB-style file with coordinates for d1nt9j_.
(The format of our PDB-style files is described here.)

Timeline for d1nt9j_: