Lineage for d1nt2a_ (1nt2 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2892669Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 2892670Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) (S)
  5. 2892887Family c.66.1.3: Fibrillarin homologue [53342] (1 protein)
    automatically mapped to Pfam PF01269
  6. 2892888Protein Fibrillarin homologue [53343] (4 species)
  7. 2892889Species Archaeoglobus fulgidus [TaxId:2234] [89737] (1 PDB entry)
    AF2087
  8. 2892890Domain d1nt2a_: 1nt2 A: [86149]
    Other proteins in same PDB: d1nt2b_
    structural genomics; complex with Nop5p (AF2088)
    protein/RNA complex; complexed with sam

Details for d1nt2a_

PDB Entry: 1nt2 (more details), 2.9 Å

PDB Description: crystal structure of fibrillarin/nop5p complex
PDB Compounds: (A:) fibrillarin-like pre-rRNA processing protein

SCOPe Domain Sequences for d1nt2a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeoglobus fulgidus [TaxId: 2234]}
kelmrnvyllddtlvtkskygshygekvfdgyrewvpwrsklaamilkghrlklrgderv
lylgaasgttvshladivdegiiyaveysakpfekllelvrernniipllfdaskpwkys
givekvdliyqdiaqknqieilkanaefflkekgevvimvkarsidstaepeevfksvlk
emegdfkivkhgslmpyhrdhifihayrf

SCOPe Domain Coordinates for d1nt2a_:

Click to download the PDB-style file with coordinates for d1nt2a_.
(The format of our PDB-style files is described here.)

Timeline for d1nt2a_: