| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
| Family c.66.1.3: Fibrillarin homologue [53342] (1 protein) automatically mapped to Pfam PF01269 |
| Protein Fibrillarin homologue [53343] (4 species) |
| Species Archaeoglobus fulgidus [TaxId:2234] [89737] (1 PDB entry) AF2087 |
| Domain d1nt2a_: 1nt2 A: [86149] Other proteins in same PDB: d1nt2b_ structural genomics; complex with Nop5p (AF2088) protein/RNA complex; complexed with sam |
PDB Entry: 1nt2 (more details), 2.9 Å
SCOPe Domain Sequences for d1nt2a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeoglobus fulgidus [TaxId: 2234]}
kelmrnvyllddtlvtkskygshygekvfdgyrewvpwrsklaamilkghrlklrgderv
lylgaasgttvshladivdegiiyaveysakpfekllelvrernniipllfdaskpwkys
givekvdliyqdiaqknqieilkanaefflkekgevvimvkarsidstaepeevfksvlk
emegdfkivkhgslmpyhrdhifihayrf
Timeline for d1nt2a_: