Lineage for d1nr1e2 (1nr1 E:10-212)

  1. Root: SCOP 1.69
  2. 473232Class c: Alpha and beta proteins (a/b) [51349] (136 folds)
  3. 489479Fold c.58: Aminoacid dehydrogenase-like, N-terminal domain [53222] (1 superfamily)
    core: 3 layers: a/b/a; parallel beta-sheet of 4 strands; 2134
  4. 489480Superfamily c.58.1: Aminoacid dehydrogenase-like, N-terminal domain [53223] (5 families) (S)
  5. 489481Family c.58.1.1: Aminoacid dehydrogenases [53224] (3 proteins)
    dimerisation domain; contains additional structures including two extra N-terminal strands in the beta-sheet
  6. 489482Protein Glutamate dehydrogenase [53225] (7 species)
  7. 489551Species Human (Homo sapiens) [TaxId:9606] [75252] (2 PDB entries)
  8. 489556Domain d1nr1e2: 1nr1 E:10-212 [86089]
    Other proteins in same PDB: d1nr1a1, d1nr1b1, d1nr1c1, d1nr1d1, d1nr1e1, d1nr1f1

Details for d1nr1e2

PDB Entry: 1nr1 (more details), 3.3 Å

PDB Description: crystal structure of the r463a mutant of human glutamate dehydrogenase

SCOP Domain Sequences for d1nr1e2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nr1e2 c.58.1.1 (E:10-212) Glutamate dehydrogenase {Human (Homo sapiens)}
dpnffkmvegffdrgasivedklvedlrtreseeqkrnrvrgilriikpcnhvlslsfpi
rrddgsweviegyraqhsqhrtpckggirystdvsvdevkalaslmtykcavvdvpfgga
kagvkinpknytdnelekitrrftmelakkgfigpgidvpapdmstgeremswiadtyas
tighydinahacvtgkpisqggi

SCOP Domain Coordinates for d1nr1e2:

Click to download the PDB-style file with coordinates for d1nr1e2.
(The format of our PDB-style files is described here.)

Timeline for d1nr1e2: